Speakenglishwithtiffani.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Welcome - Speak English with Tiffani
Description N/A
Keywords N/A
Server Information
WebSite speakenglishwithtiffani favicon www.speakenglishwithtiffani.com
Host IP 45.60.98.114
Location United States
Related Websites
Site Rank
speakenglishwithtiffaniacademy.com #1,461,111
engfluent.com #308,741
englishteacheradriana.com #417,759
speakenglishpod.com #425,320
englishanyone.com #322,268
More to Explore
spiritualarts.org
spongepedia.org
sportivostore.com
spower.com
static-nzz.ch
stemcell8.cn
stickygrammar.blogspot.com
stingtv.co.il
storesmarts.com
studbaza.by
valesofia.wordpress.com
variedadenseries.blogspot.com
Speakenglishwithtiffani.com Valuation
US$87,109
Last updated: Dec 7, 2019

Speakenglishwithtiffani.com has global traffic rank of 494,920 and ranks the 120,055th in Russia. Its global rank has gone up by 390,895 positions since 3 months ago. Speakenglishwithtiffani.com has an estimated worth of US$ 87,109, based on its estimated Ads revenue. Speakenglishwithtiffani.com receives approximately 6,364 unique visitors each day. Its web server is located in United States, with IP address 45.60.98.114. According to SiteAdvisor, speakenglishwithtiffani.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$87,109
Daily Ads Revenue US$47
Monthly Ads Revenue US$1,431
Yearly Ads Revenue US$17,421
Daily Unique Visitors 6,364
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 494,920
Delta (90 Days) ⬆️ 390,895
Most Popular In Country Russia
Country Rank 120,055
DNS Records
Host Type TTL Data
speakenglishwithtiffani.com A 14399 IP: 45.60.98.114
speakenglishwithtiffani.com A 14399 IP: 45.60.22.114
speakenglishwithtiffani.com MX 14399 Priority: 0
Target: mail.speakenglishwithtiffani.com.
speakenglishwithtiffani.com NS 21599 Target: ns2.bluehost.com.
speakenglishwithtiffani.com NS 21599 Target: ns1.bluehost.com.
speakenglishwithtiffani.com TXT 299 TXT: v=spf1 a mx ptr include:bluehost.com ?all
speakenglishwithtiffani.com TXT 299 TXT: _globalsign-domain-verification=Mp4qc3ooEmz6n-xW8IY9xtDbq4KIfl6LUdjT5UKw1w
speakenglishwithtiffani.com TXT 299 TXT: google-site-verification=UIgBwtgIWRKv2qJ-xdpqVPJuzAjXUD9fMfAdrfMoG7U
speakenglishwithtiffani.com SOA 21599 MNAME: ns1.bluehost.com.
RNAME: root.box5535.bluehost.com.
Serial: 2019100503
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 300
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Sat, 07 Dec 2019 23:20:54 GMT
Server: Apache
Vary: Accept-Encoding,Cookie
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-Redirect-By: WordPress
Set-Cookie: PHPSESSID=036f5386600fffc21b454eefb1c164da; path=/
Upgrade: h2,h2c
Connection: Upgrade
Location: https://www.speakenglishwithtiffani.com/
Content-Length: 0
Content-Type: text/html; charset=UTF-8
Set-Cookie: visid_incap_2150307=UmBDjKVpSR246u1wpB0mVdYz7F0AAAAAQUIPAAAAAAC81ShKF8J938Vsue+a6lqx; expires=Sun, 06 Dec 2020 12:52:53 GMT; path=/; Domain=.speakenglishwithtiffani.com
Set-Cookie: incap_ses_545_2150307=O3ejL3Akzj0bZye71DqQB9cz7F0AAAAAP1ST3ug1sPMrNJzVK7NbEg==; path=/; Domain=.speakenglishwithtiffani.com
Set-Cookie: ___utmvmZouFDsBZ=XunPwOujZYu; path=/; Max-Age=900
Set-Cookie: ___utmvaZouFDsBZ=OStLWMz; path=/; Max-Age=900
Set-Cookie: ___utmvbZouFDsBZ=ZZq
    XEJOXalf: BtZ; path=/; Max-Age=900
X-CDN: Incapsula
X-Iinfo: 2-168950917-168950918 NNNN CT(40 -1 0) RT(1575760854537 0) q(0 0 0 0) r(12 12) U11

HTTP/2 200 
date: Sat, 07 Dec 2019 23:20:56 GMT
server: Apache
vary: Accept-Encoding,Cookie
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
link: <https://www.speakenglishwithtiffani.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/P9nBpP-sQn>; rel=shortlink
set-cookie: PHPSESSID=4302e172193a4f3833c66e9884bcb8fc; path=/
content-type: text/html; charset=UTF-8
set-cookie: visid_incap_2150307=VwQUHqWtTh+MEzlIplnjH9cz7F0AAAAAQUIPAAAAAADXbCoVzQ7QBLfWs+l7mYNO; expires=Sun, 06 Dec 2020 12:03:51 GMT; path=/; Domain=.speakenglishwithtiffani.com
set-cookie: incap_ses_635_2150307=aUQKTEthcVe6YLITXfrPCNkz7F0AAAAAwzOOAJBRaOpXYWQgL2sNsw==; path=/; Domain=.speakenglishwithtiffani.com
x-cdn: Incapsula
x-iinfo: 10-197583083-197583085 NNNN CT(147 298 0) RT(1575760855815 0) q(0 0 4 0) r(19 19) U12

Speakenglishwithtiffani.com Whois Information
   Domain Name: SPEAKENGLISHWITHTIFFANI.COM
   Registry Domain ID: 2028864775_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.namecheap.com
   Registrar URL: http://www.namecheap.com
   Updated Date: 2019-04-17T09:33:05Z
   Creation Date: 2016-05-17T07:11:49Z
   Registry Expiry Date: 2020-05-17T07:11:49Z
   Registrar: NameCheap, Inc.
   Registrar IANA ID: 1068
   Registrar Abuse Contact Email: abuse@namecheap.com
   Registrar Abuse Contact Phone: +1.6613102107
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: NS1.BLUEHOST.COM
   Name Server: NS2.BLUEHOST.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain name: speakenglishwithtiffani.com
Registry Domain ID: 2028864775_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-04-17T09:33:05.51Z
Creation Date: 2016-05-17T07:11:49.00Z
Registrar Registration Expiration Date: 2020-05-17T07:11:49.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited 
Registry Registrant ID: 
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411 
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code: 
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext: 
Registrant Fax: +51.17057182
Registrant Fax Ext: 
Registrant Email: 1f486ef2d78f4198be397ffda6a9ff91.protect@whoisguard.com
Registry Admin ID: 
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411 
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code: 
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext: 
Admin Fax: +51.17057182
Admin Fax Ext: 
Admin Email: 1f486ef2d78f4198be397ffda6a9ff91.protect@whoisguard.com
Registry Tech ID: 
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411 
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code: 
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext: 
Tech Fax: +51.17057182
Tech Fax Ext: 
Tech Email: 1f486ef2d78f4198be397ffda6a9ff91.protect@whoisguard.com
Name Server: ns1.bluehost.com 
Name Server: ns2.bluehost.com 
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/